Protein Info for Pf6N2E2_4642 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 48 to 71 (24 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 32 to 268 (237 residues), 179.5 bits, see alignment E=3.8e-57

Best Hits

Swiss-Prot: 55% identical to YFDC_ECOLI: Inner membrane protein YfdC (yfdC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a5281)

Predicted SEED Role

"Putative transport"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A096 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Pf6N2E2_4642 Putative transport (Pseudomonas fluorescens FW300-N2E2)
MDTHKDGKTPDLSAQEQHEVDRNQPPRAAVLHEIIRTQGNQELERSIAALWWSALAAGLT
MGLSLMAMGLLNSRLPDHEGFKVIASFGYCAGFLAVILARQQLFTENTLTAVLPIMSKPT
LGNFGRLLRLWGVVLVGNLCGTLLVAYVMLHLPIFDPRTDQAFLEIGRKVMENDTGQMFA
KGIISGWMIATMVWMIPSMESAKMWIITLITYLMALGDFTHIVVGSAEVSYLVFAGQLSW
EDFWMVFAGPTLAGNIIGGSFIFALISHAQIRSEVGLPKDKGAAEPARRIDPE