Protein Info for Pf6N2E2_464 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sensory histidine kinase QseC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details PF00512: HisKA" amino acids 212 to 276 (65 residues), 39.8 bits, see alignment E=3.8e-14 PF02518: HATPase_c" amino acids 324 to 432 (109 residues), 86 bits, see alignment E=2.5e-28

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a3395)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YUG0 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Pf6N2E2_464 Sensory histidine kinase QseC (Pseudomonas fluorescens FW300-N2E2)
MWKLLIRLYLVTIVSYSAAIYLMPELVIRLFQDRFMTYNLDYSRGLQTLMVKQFRAVPSE
QWPALAAQMDKEFEPLRIELAAIDDGGFSADEQARLKRGENVVRIGDWAWRTLAAAPLDG
RTAVKMVVPPDPADVSWLYWSINVLIGATMLACLLLWLRPHWRDLERLRRTAERFGKGHL
GERTHIASSSNIGSLAHVFDTMAGDIENLLNQQRDLLNAVSHELRTPLTRLDFGLALALS
DDLPPASRERLQGLVAHIRELDELVLELLSYSRLQNPQRLPERVEVALDEFIDSILGSVD
EDLAAPDVVIDVLLHGALERFVLDPRLTARALQNLLRNAMRYCEKRIQVGVLVSDQGCEI
WVDDDGIGIPDSERERVFEPFYRLDRSRDRATGGFGLGLAISRRALEAQGGTLTVEASPL
GGARFRLWLPTPA