Protein Info for Pf6N2E2_4625 in Pseudomonas fluorescens FW300-N2E2

Annotation: Malonyl CoA acyl carrier protein transacylase (EC 2.3.1.39)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 76 to 96 (21 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details TIGR03131: malonate decarboxylase, epsilon subunit" amino acids 4 to 296 (293 residues), 353.4 bits, see alignment E=5.6e-110 PF00698: Acyl_transf_1" amino acids 5 to 280 (276 residues), 99.8 bits, see alignment E=2.2e-32

Best Hits

KEGG orthology group: K13935, malonate decarboxylase epsilon subunit [EC: 2.3.1.39] (inferred from 95% identity to pba:PSEBR_a5300)

Predicted SEED Role

"Malonyl CoA acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Malonate decarboxylase (EC 2.3.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.39

Use Curated BLAST to search for 2.3.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A380 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Pf6N2E2_4625 Malonyl CoA acyl carrier protein transacylase (EC 2.3.1.39) (Pseudomonas fluorescens FW300-N2E2)
VSSLFVFPGQGAQRAGMLQGLAPQVLDEATDVLGEDVLQLDSAEALQSTRAVQLCLLIAG
VAAARQLLEQAPAPDYVAGLSIGAYPAAVVAGALGFEDALRLVSLRGELMQQAYPQGYGM
TAIIGLDLAAVEALLAQVHSDHTPVYLANINADNQVVIAGNDEAMNNVARQARSLGAGKA
CRLAVSVPSHCPLLEAPARALAQAFADVSLKAPALGYLSGSRARPLIDTEALRDDLAFNM
CRVVDWRGTVQSAYERGVRLQIELPPGAVLTALARRVFEQGTVMAFDGARLDTLQALLRE
EGNRQP