Protein Info for Pf6N2E2_4539 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 87 to 114 (28 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details TIGR01404: type III secretion protein, YscU/HrpY family" amino acids 6 to 348 (343 residues), 371.2 bits, see alignment E=2.8e-115 PF01312: Bac_export_2" amino acids 6 to 345 (340 residues), 318.2 bits, see alignment E=3.4e-99

Best Hits

KEGG orthology group: K03229, type III secretion protein SctU (inferred from 98% identity to pba:PSEBR_a5379)

Predicted SEED Role

"Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1M5 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Pf6N2E2_4539 Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components) (Pseudomonas fluorescens FW300-N2E2)
MSEDSGEKTKRATPKKIRDARNKGQVGQSQDLSSLLVLAAITEVALTQADDSMQALGDMV
AFPLHRLDVDFVRAFEETLAHAGGVLLNFTLMTVGLAIVTRLVAGWIQFGFLFAPEALQP
DPNRLNPMNQAKQMFSGQALINLFMGLVKAVFIGTVIYLVTLPALGSLISLVNGDLHSYW
RGLASLFRHIMHICLGVLLVLAILDFGLQKYFFAKRLRMSEEEVRKEFKEMEGDPHVKMH
RRSLARQLVDQPVNKETKPVEDADMLVVNPTHFAVALLYRPEETPLPQLIVKGVDAEARA
LIERAKAARVPVIQCIWLARTIYREDVGGYIPRETLQAVAHIYRVLRELDDEAKGEVIEI
PELNQR