Protein Info for Pf6N2E2_4505 in Pseudomonas fluorescens FW300-N2E2

Annotation: Alkanesulfonates transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 63 to 85 (23 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 243 (168 residues), 107.7 bits, see alignment E=3e-35

Best Hits

Swiss-Prot: 74% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 98% identity to pba:PSEBR_a5410)

MetaCyc: 74% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1W2 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Pf6N2E2_4505 Alkanesulfonates transport system permease protein (Pseudomonas fluorescens FW300-N2E2)
MKKIIHNLAPWAVPLLLLAVWQLSVSTGWLSTRILPAPVAVIEAGANLVRSGEIWTHLAI
SGWRAAVGFLIGGGIGLALGFITGLSKWGERLLDSSVQMLRNIPHLALIPLVILWFGIDE
SAKIFLVALGTLFPIYLNTYHGIRNVDPALVEMSRSYGLSGLRLFRQVILPGALPSILVG
VRFALGFMWLTLIVAETISASAGIGYLAMNAREFLQTDVVVLAILLYAVLGKLADLAARG
LERVWLRWHPAYQVDKGGAA