Protein Info for Pf6N2E2_45 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF01136: Peptidase_U32" amino acids 44 to 374 (331 residues), 353.3 bits, see alignment E=9.6e-110 PF16325: Peptidase_U32_C" amino acids 386 to 467 (82 residues), 76 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 73% identical to YEGQ_ECOLI: Uncharacterized protease YegQ (yegQ) from Escherichia coli (strain K12)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 98% identity to pba:PSEBR_a3886)

Predicted SEED Role

"Putative protease"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H5E3 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Pf6N2E2_45 Putative protease (Pseudomonas fluorescens FW300-N2E2)
VPSRLRRALIQINKAWPTMGYPRRLLRSDAIMTLAAPELLAPAGTLKNMRYAFAYGADAV
YAGQPRYSLRVRNNEFDHANLALGIAEAQAMGKRFYVVVNIAPHNAKLRTFLKDLEPVIA
MAPDALIMSDPGLIMLVRRHFPQMPIHLSVQANTVNWASVEFWQQQGLSRIILSRELSLE
EIAEIREQVPAMELEVFVHGALCMAYSGRCLLSGYLNKRDANQGSCTNACRWKYAAQPAV
ENIVGDIVQSYQPEPTLGLGAPTDQVFLLQEANRPEESMPAFEDEHGTYIMNAKDLRAVQ
HVERLARMGVHSLKIEGRTKSHFYCARTTQVYRRAIDDAVAGREFDRGLMTDLESLAQRG
YTEGFLRRHVHDEYQNYQNGSSVSERQQFVGELTGARRERLAEVRVKNRFGLGDHMELMT
PKGNFHFDLHQLQNAKGQGIEVAPGDGHVVYLPIPDAVDLRFGLLMRDVRELPA