Protein Info for Pf6N2E2_4484 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ferric iron ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 227 to 252 (26 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details amino acids 361 to 385 (25 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details amino acids 454 to 477 (24 residues), see Phobius details amino acids 511 to 530 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 68 to 251 (184 residues), 51.4 bits, see alignment E=5.8e-18 amino acids 356 to 524 (169 residues), 31.6 bits, see alignment E=6.7e-12

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 98% identity to pba:PSEBR_a5428)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2Y1 at UniProt or InterPro

Protein Sequence (538 amino acids)

>Pf6N2E2_4484 Ferric iron ABC transporter, permease protein (Pseudomonas fluorescens FW300-N2E2)
LAHPVQRRWYPLVFAIAALVLLPLSVLLLSWQSIDQQIWSHLWDTQMPRLLGNTLTLILG
VGVGVTLLGVSLAWLTSLCEFPGRRWLDWALMLPFAIPAYVLAFVFVGLLDFAGPVQTLM
REWFGSGLRLPRVRSTGGVILVLVLVFYPYVYLLARSAFLAQGKGLMEAARVLGQSPWQA
FWRVALPMARPAIGAGVALALMETLADFGAVSVFNFDTFTTAIYKTWYGFFSLSSAAQLA
SLLLLAVMLVVYGERRARGAHRASNERPRAKALYTLRGLKAAAASSWCFLVFACAFVIPV
LQLVVWFWQRGRFDLDERYAGLIVHTLYLGGLAALITVCVALLLAFARRLAPTRPIRAGV
GLANLGYALPGSVLAVSIMLAFSYLDRELVIPLSTWLGGAGKPLLLGSLSALLLAYLVRF
LAVAYGPLESSLARIRPSLPEAARSLGVSGPRLFFKVYLPLLLPGTLSAALLVFVDVLKE
MPATLLMRPFGWDTLAVRIFEMTSEGEWARAALPALTLVLVGLLPVIGLIRRSAHRNS