Protein Info for Pf6N2E2_4483 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ferric iron ABC transporter, iron-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF13531: SBP_bac_11" amino acids 80 to 335 (256 residues), 50 bits, see alignment E=7.1e-17 PF01547: SBP_bac_1" amino acids 85 to 331 (247 residues), 66.1 bits, see alignment E=1.1e-21 PF13416: SBP_bac_8" amino acids 94 to 361 (268 residues), 76.5 bits, see alignment E=6.4e-25 PF13343: SBP_bac_6" amino acids 127 to 349 (223 residues), 61.5 bits, see alignment E=1.8e-20

Best Hits

Swiss-Prot: 80% identical to P5217_PSEAE: Probable binding protein component of ABC iron transporter PA5217 (PA5217) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 96% identity to pba:PSEBR_a5429)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1I6 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Pf6N2E2_4483 Ferric iron ABC transporter, iron-binding protein (Pseudomonas fluorescens FW300-N2E2)
MWVGAYARDDGRKNTAHLKVATFGNVSTHCSIELPNVSPYHLRFVHNPETATMLATKRLL
SALALTLIGSTAVQAADEVVVYSSRIDELIKPVFDTYTKETGVSVKFITDKEAPLMQRIK
AEGENATADLLLTVDAGNLWQAEQMGILQPFTSPVIDANIPSQYRASSHAWTGLSLRART
IVYSTERVKPSELTTYEALAGKEWEGRLCLRTSKKVYNQSLTATLIETHGAEKTEEILKG
WVRNLSTDVFSDDTALLEAINAGQCDVGIVNTYYYGRLHQQKPDLKVKLFWPNQADRGVH
INLSGIGLTKHAPHPDAAKKLVEWMTTPQAQSIFADVNQEFPANPKVEPSKEVAAWGKFK
ADTLPVEVAGKRQAEAIRMMDRAGWN