Protein Info for Pf6N2E2_4388 in Pseudomonas fluorescens FW300-N2E2

Annotation: Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF01494: FAD_binding_3" amino acids 38 to 70 (33 residues), 23.4 bits, see alignment (E = 6.5e-09) PF00890: FAD_binding_2" amino acids 39 to 68 (30 residues), 21.9 bits, see alignment (E = 1.9e-08) PF01266: DAO" amino acids 39 to 392 (354 residues), 246.8 bits, see alignment E=1e-76 PF13450: NAD_binding_8" amino acids 42 to 87 (46 residues), 27.6 bits, see alignment 5.6e-10

Best Hits

Swiss-Prot: 46% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 99% identity to pba:PSEBR_a5511)

MetaCyc: 46% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]

Predicted SEED Role

"Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.-

Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2R0 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Pf6N2E2_4388 Gamma-glutamyl-putrescine oxidase (EC1.4.3.-) (Pseudomonas fluorescens FW300-N2E2)
MNARVQQPVPSHAHAASYYAASSLPQPDHPLLQGELLADVCVVGGGFSGLNTAIELAERG
MSVVLLEAHRIGWGASGRNGGQLIRGVGHGLDQFAPIIGADGVRQMKLMGLEAVEIVRQR
VERFQIPCDLTWGYCDLANKPSDLEGFAEDAEELRSLGYRHPTRLLQANEMHSVVGSDRY
VGGLIDMGSGHLHPLNLALGEAAAAQQLGVRLFEQSAVTRIDYGPEVKVHTQQGSVRAKT
LVLGCNAYLNGLNPQLGGKVLPAGSYIIATEPLSQAQAQALLPQNMAVCDQRVALDYYRL
SADRRLLFGGACHYSGRDPQDIGAYMRPKMLKVFPQLADVKIDYQWGGMIGIGANRLPQI
GRLKDQPNVYYAQAYSGHGVNATHLAGKLLAEAISGQHSSGFDLFAQVPHMTFPGGKHLR
SPLLALGMLWHRLKELV