Protein Info for Pf6N2E2_4388 in Pseudomonas fluorescens FW300-N2E2
Annotation: Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)
KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 99% identity to pba:PSEBR_a5511)MetaCyc: 46% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]
Predicted SEED Role
"Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)"
MetaCyc Pathways
- superpathway of L-arginine and L-ornithine degradation (11/13 steps found)
- superpathway of ornithine degradation (7/8 steps found)
- putrescine degradation II (4/4 steps found)
- superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (9/11 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.4.3.-
Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A160A2R0 at UniProt or InterPro
Protein Sequence (437 amino acids)
>Pf6N2E2_4388 Gamma-glutamyl-putrescine oxidase (EC1.4.3.-) (Pseudomonas fluorescens FW300-N2E2) MNARVQQPVPSHAHAASYYAASSLPQPDHPLLQGELLADVCVVGGGFSGLNTAIELAERG MSVVLLEAHRIGWGASGRNGGQLIRGVGHGLDQFAPIIGADGVRQMKLMGLEAVEIVRQR VERFQIPCDLTWGYCDLANKPSDLEGFAEDAEELRSLGYRHPTRLLQANEMHSVVGSDRY VGGLIDMGSGHLHPLNLALGEAAAAQQLGVRLFEQSAVTRIDYGPEVKVHTQQGSVRAKT LVLGCNAYLNGLNPQLGGKVLPAGSYIIATEPLSQAQAQALLPQNMAVCDQRVALDYYRL SADRRLLFGGACHYSGRDPQDIGAYMRPKMLKVFPQLADVKIDYQWGGMIGIGANRLPQI GRLKDQPNVYYAQAYSGHGVNATHLAGKLLAEAISGQHSSGFDLFAQVPHMTFPGGKHLR SPLLALGMLWHRLKELV