Protein Info for Pf6N2E2_4336 in Pseudomonas fluorescens FW300-N2E2

Annotation: Uncharacterized protein ImpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR03363: type VI secretion-associated protein, ImpA family" amino acids 2 to 343 (342 residues), 275.7 bits, see alignment E=4.3e-86 PF06812: ImpA_N" amino acids 7 to 130 (124 residues), 109 bits, see alignment E=7.8e-36

Best Hits

KEGG orthology group: K11902, type VI secretion system protein ImpA (inferred from 94% identity to pba:PSEBR_a5557)

Predicted SEED Role

"Uncharacterized protein ImpA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A182 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Pf6N2E2_4336 Uncharacterized protein ImpA (Pseudomonas fluorescens FW300-N2E2)
VDVPLLLAAVSATSPCGEDLEYDADFLRLERDSRGQPERSMGDSILPAEPPEWRSIQQQS
LDLLQRSKDLRITHFLLQSSLALEGLPGMARVLTLISELLKQYWAELHPRLDADDDNDPT
VRINALAGLTSDVTIRLLRESILVRSRTFGAVSLRAAANASGLQSFSDENLGAEQLAGAL
LDSDPEQLEIIRAALQEARSAAETIEQQVSDQVGSAQGVDLGPLKQPLKMALQILGQFAP
QSGDSAQADSVSDNSAAPSEHANGTSSPRNTNNSTSTVSGDINNRDDVLRSLDRILAYYT
RHEPSSPLPVLLNRAKNLVHADFAAIVRNLIPDGMSQFENLRGPDSE