Protein Info for Pf6N2E2_4280 in Pseudomonas fluorescens FW300-N2E2

Annotation: serine protease, subtilase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 TIGR01414: outer membrane autotransporter barrel domain" amino acids 245 to 619 (375 residues), 102.2 bits, see alignment E=1.7e-33 PF03797: Autotransporter" amino acids 361 to 609 (249 residues), 206.5 bits, see alignment E=3e-65

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1A4 at UniProt or InterPro

Protein Sequence (630 amino acids)

>Pf6N2E2_4280 serine protease, subtilase family (Pseudomonas fluorescens FW300-N2E2)
MLRLEASKGGKLEGAHNFEALHVAKGEWEHTGNFTGWGVIEPETTLINTGHIDGQIGVLG
TFDNKGVVANNVIVEQDAGMSNSGAVNGAVHVLEKASFSGNGSVGFLSVAGQLKVGPEVG
APSISGNLELLKGAELIYGIDAAGASATINVAGTATLNDATLRIDAVQVEDMGTSEHTVI
RAKQIEGAFGTIINNLPFMTATPHYSGTEVGLTYARNGVPLNAAAKNENAERLAGSIKEP
QTATPLPPKPVDNGAAAEAPTTQAKVDDPAQRPRQASPVASIEPKPTSLPHNIPVAKPNA
AINALLGSNLVTAADALDQLSGYDTADLGNATLSSVAPISTGMLAAMGQNTSQGAHGNGQ
VWVQAIGNSGRVGKHLDDYALKHSTTGLLLGTDWAINPTWRIGIIGAKSETRLDGHRFEG
RLDSWHVGAYALRQDGPLALRLGAVYGDHDGSTKRHVAFNGFSDRLKGRYDANTQQVFGQ
VGYNLDVGHFDIEPYVQLGYQHYQRDHFKEKGGDAALQFESQTQDHYTSELGLHLARPFV
LDQGARLTPRLNVGWKHLYGDVRGSSRQRLVDGGMTYTVEGIELDRDSLLLEAGLDLAVS
PRHTLGVSYKGETGQDNHNGALMGQWRMMF