Protein Info for Pf6N2E2_4274 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sensory box/GGDEF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 946 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 86 to 112 (27 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 292 to 389 (98 residues), 33.5 bits, see alignment E=3.9e-12 amino acids 394 to 511 (118 residues), 52.4 bits, see alignment E=5.9e-18 PF08447: PAS_3" amino acids 293 to 376 (84 residues), 69.4 bits, see alignment E=9.2e-23 amino acids 415 to 498 (84 residues), 25.8 bits, see alignment E=3.8e-09 PF13188: PAS_8" amino acids 395 to 443 (49 residues), 23.7 bits, see alignment 1.2e-08 PF00989: PAS" amino acids 396 to 501 (106 residues), 36.7 bits, see alignment E=1.3e-12 PF08448: PAS_4" amino acids 397 to 507 (111 residues), 41.6 bits, see alignment E=4.7e-14 PF13426: PAS_9" amino acids 402 to 503 (102 residues), 42.3 bits, see alignment E=2.8e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 515 to 675 (161 residues), 104.1 bits, see alignment E=6.7e-34 PF00990: GGDEF" amino acids 517 to 673 (157 residues), 137.8 bits, see alignment E=1.1e-43 PF00563: EAL" amino acids 694 to 929 (236 residues), 248.9 bits, see alignment E=1.6e-77

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a5596)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GUN0 at UniProt or InterPro

Protein Sequence (946 amino acids)

>Pf6N2E2_4274 Sensory box/GGDEF family protein (Pseudomonas fluorescens FW300-N2E2)
VEPRVICKQYAMEMAVERTRLLYQGSLLPTLFMLLNGLVCAALLWEPRRYFLVSVWLVWL
LSLVALRVIQVAAFDSAMPSRQAHPIWLRMFLLGSAMTGLTLAGAGIALVPADSFQQQAW
VFGLIGAAALSASVAYAVSLPAFLSFTLPCLLPAIGYLFWGGDEQQRGWGWLGLIVLVSL
SVVAWQVNRLIQSGLLRRFQNQALIEHLQQAQTRSAQLNDALAREVEQRRSAEEKLRAAQ
VGLEARVAQRSLELEVASQALSKSEARLALALKASELGLWDWNLQTDEVHHTQLKELFGL
EPEYITAMLTHLTPRLHPQDLPALKRALVEHLKGRSEDYQIEYRVRHGDGHWVWIEDRGR
AVERSVSGRVLRMVGTRRDISTSKELEQQRQLAATVFEAASEGIVIFDPHYVLLAANQAF
TRVTGFNIDDMLGRNVVDLPCSRDARRHYPVIRQALKQHGTWQGELVEARANGELYPQWL
QLNVVRNARGNVSHIVGFFADLSARRESEERMRYLTHYDELTGLANRSLFRERLHEAHQR
VRQGGRRSLALLHINLDRFKLLNDSLGHDIADQLLQKMARRLINALPEADTIARLSGDEF
AVLFDAYGNLSSLARVATRLAAKLRVPLTIEGHELVLSASIGISLLPDNTREVAMLVSQA
NMAMQHAKHLGGNNFQFYTDSLQASTLERLQLENQLRKALEEQQLKVFYQPKLCLATGRL
NAAEALVRWDHPAMGRVPPGDFIGLAEETGLIGPIGEFVLRQACWQACEWQRQGLAPIRV
SVNLSVHQLRQGKLVSLVRQVLEETGLAPQYLELELTESQLLDSVEHIIATFQQLRDLGV
KLAIDDFGTGYSSLSYLKRIPVDYVKIDQAFIRGLGEGSVDAAITRAIIAMAHGLSLKVV
AEGVERQEQLEFLRSERCDEVQGYLVSRPVEAEGLAGLLRAQHLVE