Protein Info for Pf6N2E2_4257 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cardiolipin synthetase (EC 2.7.8.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details PF13396: PLDc_N" amino acids 22 to 60 (39 residues), 25.5 bits, see alignment 1.6e-09 TIGR04265: cardiolipin synthase" amino acids 23 to 479 (457 residues), 367.5 bits, see alignment E=6.1e-114 PF13091: PLDc_2" amino acids 136 to 245 (110 residues), 30.5 bits, see alignment E=4.3e-11 amino acids 320 to 446 (127 residues), 100.9 bits, see alignment E=7.5e-33 PF00614: PLDc" amino acids 393 to 419 (27 residues), 30.8 bits, see alignment (E = 3.2e-11)

Best Hits

Swiss-Prot: 87% identical to CLSA_PSEF5: Cardiolipin synthase A (clsA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 96% identity to pba:PSEBR_a5613)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2E8 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Pf6N2E2_4257 Cardiolipin synthetase (EC 2.7.8.-) (Pseudomonas fluorescens FW300-N2E2)
MDYFGPHVFGYLIALLHTLGSIAAVHAVLTVRTAQGSIAWALSLTFIPYLTLIPYLVFGR
STFDGYIKARRQANEEMRKAISELNWRPWVEEALTARASQAYASLRAMPKLGRTPCLANN
QVRLLVNGHATFEAIFQAIEQARQAVLIQFFIIHDDRLGQRLHSLLLKKAAEGVAVYLLY
DRIGSHSLPHRYVQALRDGGVHVKAFATRSGWLNRFQVNFRNHRKIVVVDGVQGFVGGHN
VGDEYMGDKPPLAPWRDTHVQVCGPVVASMQESFAEDWFWAARSLPPLILPDSYPDDGVL
CQLLASGPADAYETCSLFFVEAIHAASERVWITTPYFIPDEAVFAALRLAVLRGVDVRIL
LPSRPDHKIVYAASSLYAFEAVRAGVRMFRYGPGFLHQKVVLIDREISAIGSANLDNRSF
RLNFEVMLLTVDIPFATEVEQMLEQDFAQAVEIDKQESRETHRLQKIGMRIARLISPIL