Protein Info for Pf6N2E2_4256 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF02353: CMAS" amino acids 56 to 330 (275 residues), 371.6 bits, see alignment E=9.4e-115 PF01728: FtsJ" amino acids 105 to 205 (101 residues), 24.3 bits, see alignment E=1.1e-08 PF13489: Methyltransf_23" amino acids 108 to 227 (120 residues), 33.9 bits, see alignment E=1e-11 PF05175: MTS" amino acids 109 to 191 (83 residues), 24.4 bits, see alignment E=8.1e-09 PF13847: Methyltransf_31" amino acids 118 to 217 (100 residues), 39.7 bits, see alignment E=1.6e-13 PF13649: Methyltransf_25" amino acids 122 to 217 (96 residues), 69.2 bits, see alignment E=1.7e-22 PF08241: Methyltransf_11" amino acids 122 to 219 (98 residues), 58.5 bits, see alignment E=3.5e-19 PF08242: Methyltransf_12" amino acids 122 to 218 (97 residues), 48.5 bits, see alignment E=4.9e-16

Best Hits

Swiss-Prot: 78% identical to FAMT_PSEPU: Probable fatty acid methyltransferase from Pseudomonas putida

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 99% identity to pba:PSEBR_a5614)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A115 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Pf6N2E2_4256 Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79) (Pseudomonas fluorescens FW300-N2E2)
MVAQFTHPSLDALGAAFVEGKLELEGSIHEVIRVCDEWSQALVEDDADNPPVRSLHDKET
DAKAISYHYDLSNAFYQLWLDSDMAYSCAYFETGSETLEQAQQAKFRHLCRKLRLQPGDY
LLDVGCGWGGLARYAAREFGAKVFGITLSKAQLALARERVKAEGLEDSVELQLLDYRDLP
QDGRFDKVVSVGMFEHVGHANLEQYCKTLFGAVREGGLVMNHGITAKHTDGRPVGRGAGE
FIEKYVFPNGELPHLSMISAEISEAGLEIVDVESLRLHYARTLDHWSERLEDNLEAAAKE
VPEQALRIWRLYLAGCAYAFAKGWINLHQILAVKAHADGSHELPWTRDDIYTP