Protein Info for Pf6N2E2_4180 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG00955126: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 214 to 373 (160 residues), 166.2 bits, see alignment E=2.6e-53 PF00990: GGDEF" amino acids 216 to 370 (155 residues), 147.3 bits, see alignment E=1.7e-47

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a20)

Predicted SEED Role

"FIG00955126: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A379 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Pf6N2E2_4180 FIG00955126: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MYGPRLRNGQDFVIAEQVRTDRLQQLFRQSVSAVFGSYLAAIMLSWLCWDRFDHGAIFWW
MAILTASTLLRIAMFVAYFRSDESQRTPRHWERKYWVTLVLSASIWGGGAFVLMPADDLL
SQALVMLFTVGMSVSAVSCYSAYRDMTLVSIGVVLLPCTIWLLFQPSPIQLGMALSILVF
AAFAARATHKMSQALEIAFRLTREMEQANSISTRAAQTDELTGLKSRRAFFEHAQQLYDE
CKAKRQGLCAVMLDMDHFKHINDTYGHQVGDQVLRQMGTVISSSFRATDIHGRLGGEEFA
ILLPNTSIEVATQIAERLIDTIAGLMIEPVLCISASLGVASTEACNKDLHSLMNDADKAL
YRAKALGRNRVAVA