Protein Info for Pf6N2E2_4138 in Pseudomonas fluorescens FW300-N2E2

Annotation: Uncharacterized transporter, similarity to citrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 99 to 126 (28 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 255 to 272 (18 residues), see Phobius details amino acids 279 to 304 (26 residues), see Phobius details amino acids 316 to 341 (26 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details TIGR00784: citrate transporter" amino acids 1 to 429 (429 residues), 625.2 bits, see alignment E=3.7e-192 PF03600: CitMHS" amino acids 14 to 377 (364 residues), 130.1 bits, see alignment E=5.4e-42

Best Hits

Swiss-Prot: 62% identical to CITN_BACSU: Citrate transporter (citN) from Bacillus subtilis (strain 168)

KEGG orthology group: K03300, citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family (inferred from 98% identity to pfl:PFL_0105)

Predicted SEED Role

"Uncharacterized transporter, similarity to citrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A244 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Pf6N2E2_4138 Uncharacterized transporter, similarity to citrate transporter (Pseudomonas fluorescens FW300-N2E2)
MLTFLGFAMVITFMFLIMTKRLSALIALIIIPILFALFGGFAPKIGPMMLEGITKLAPTG
VMLMFAILYFALMIDSGLFDPAVRKILKLVKGDPLKVSVGTAVLALVVSLDGDGATTYMI
CVAAMLPLYSRIGMSPRIMAGLIILAGGVMNMTPWGGPTARAASALHVDPSDIFVPMIPA
MLAGVVAILAISYMYGKRERARLGELHLVGDEIDHSEISVSQFPDARRPKLIWFNGALTL
GLMCTLIAGLLPLPVLFMVAFSIAMIVNYPCLQQQKDRVAAHAGSVLAVVGLIFAAGIFT
GILSGTGMVDAMSKSLLAVIPEFLGPYLAVITALVSMPFTFFMSNDAFYYGVLPVLAEAA
SHYGITAVEMARASIVGQPVHLLSPLVPSTYLLVALAGIEFGDHQRFTLKWAVLVCLCIM
FAALLMGIFPLFSTL