Protein Info for Pf6N2E2_4113 in Pseudomonas fluorescens FW300-N2E2

Annotation: Redox-sensing transcriptional regulator QorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 36 to 53 (18 residues), see Phobius details PF01638: HxlR" amino acids 35 to 121 (87 residues), 102.2 bits, see alignment E=5.6e-34

Best Hits

Swiss-Prot: 59% identical to YTFH_SHIFL: Uncharacterized HTH-type transcriptional regulator YtfH (ytfH) from Shigella flexneri

KEGG orthology group: None (inferred from 66% identity to psb:Psyr_2312)

Predicted SEED Role

"Redox-sensing transcriptional regulator QorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A372 at UniProt or InterPro

Protein Sequence (136 amino acids)

>Pf6N2E2_4113 Redox-sensing transcriptional regulator QorR (Pseudomonas fluorescens FW300-N2E2)
VDTTTEISEPFSAAVRRGDVQSADCPSREVLKHMTSRWGVLVLVMLLGGMHRFSELRRKI
GGVSEKMLSQTLQELEADGLVDRKSLPVVPPHVEYRLTPLGREAAEHLEVMVNWIEEKIP
QIMAVRRSRLGDGTEE