Protein Info for Pf6N2E2_4106 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 15 to 293 (279 residues), 353.2 bits, see alignment E=7.1e-110 PF01040: UbiA" amino acids 30 to 279 (250 residues), 234.3 bits, see alignment E=7.2e-74

Best Hits

Swiss-Prot: 92% identical to CYOE1_PSEPF: Protoheme IX farnesyltransferase 1 (cyoE1) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 99% identity to pba:PSEBR_a88)

MetaCyc: 34% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A226 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Pf6N2E2_4106 Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone (Pseudomonas fluorescens FW300-N2E2)
MATLTGERHSQAIWRDYLELTKPKVVVLMLITSLVGMFLATRAGVPWTVLVFGNLGIALC
AGGAAAVNHVVDRRIDAVMARTHKRPLAEGRISPAAALTFALALAVIGQALLLAFTNPLT
AWLTLASLLGYAVVYTGFLKRATPQNIVIGGLAGAAPPLLGWVAATGHVSAEPLLLVLII
FAWTPPHFWALAIHRKEEYAKADIPMLPVTHGEHYTKVHILLYTLVLLAVSLMPFVIQMS
GMLYLICALVLGARFLQWAVVLYRGSRPHAAINTFKYSIYYLFLLFIALLVDHYLLLSL