Protein Info for Pf6N2E2_4096 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sulfate transporter family protein in cluster with carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 322 to 351 (30 residues), see Phobius details amino acids 371 to 399 (29 residues), see Phobius details PF00916: Sulfate_transp" amino acids 12 to 377 (366 residues), 220.7 bits, see alignment E=1.4e-69

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a97)

Predicted SEED Role

"Sulfate transporter family protein in cluster with carbonic anhydrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A311 at UniProt or InterPro

Protein Sequence (508 amino acids)

>Pf6N2E2_4096 Sulfate transporter family protein in cluster with carbonic anhydrase (Pseudomonas fluorescens FW300-N2E2)
MRAQLKAVLPRELLASVVVFLVALPLCMGIAIASGLPPAKGLITGIIGGLVVGFLAGSKL
QVSGPAAGLAVLVFELVRQHGVAMLGPILLLAGLLQLLAGRFRLGCWFRVTAPAVVYGML
AGIGVLIVLSQVHVMLDAAPKPSGLDNLAAFPAAVAQALPSFGWQAGLLGLSTIAVMWLW
EKFRPHSLRFIPGALLGVGLATIASLLLALQVKRVEVPENLAEAIDWLRPADLLNLADPT
LLIAAFAVAFIASAETLLSAAAVDRMHSGDRADFDRELSAQGIGNMLCGLLGALPMTGVI
VRSSANVQAGATTRMSTIFHGLWLLLFVLLLSSVLQSIPVASLAGVLVYTGFKLVDLKAF
RGLGRYGRMPMFVYAATALAIIFTDLLTGVLIGFGLTLAKLAWKASRLKISLIDLPQEGE
MELRLVGAATFLKVPALTQVLGSIPTGATVHVPLNNLSYIDHSCLELLEEWGRANASKGS
KLLIESRGLKRRLEGRLRTTVGVGAASA