Protein Info for Pf6N2E2_3990 in Pseudomonas fluorescens FW300-N2E2

Annotation: Chemotactic transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 26 (3 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details PF02743: dCache_1" amino acids 34 to 256 (223 residues), 89.3 bits, see alignment E=5.9e-29 PF22673: MCP-like_PDC_1" amino acids 98 to 176 (79 residues), 50.4 bits, see alignment E=5.9e-17 PF00672: HAMP" amino acids 293 to 346 (54 residues), 46 bits, see alignment 1.1e-15 PF00015: MCPsignal" amino acids 409 to 590 (182 residues), 149.1 bits, see alignment E=2.4e-47

Best Hits

Swiss-Prot: 78% identical to MCPA_PSEPK: Methyl-accepting chemotaxis protein McpA (mcpA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 99% identity to pba:PSEBR_a196)

Predicted SEED Role

"Chemotactic transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GTL0 at UniProt or InterPro

Protein Sequence (626 amino acids)

>Pf6N2E2_3990 Chemotactic transducer (Pseudomonas fluorescens FW300-N2E2)
MNLKFSHKILLAASGVVVLAFALFTLYNDYLQRNTIGSSLESSIEQSGDLTASSIQNWMS
GRILVLENLAQNIAHQGTAADLPGLVDQPALTSNFQFTYVGQANGVFTQRPDAKMPDGYD
PRQRPWYKQAVTADKTMLTPPYLAAVGGLVVTVALPVKHNGELLGVVGGDLSLETLVKII
NSVDFGGIGHAFLVSGDGQVIVSPDKDQVMKNLKDIYPGTPVRIGKGIQDVELNGQDRIL
SFTPVTGLPNAEWYIGLSIDKAKAYAPLSQFRTSALIAMFVAVAAIALLLSLLIQVLMRP
LTTMGRAMQDIAQGEGDLTRRLVVQGKDEFAVLGGSFNQFVERIHASISEVSSATRQVHD
LSQRVMTSSNASLVGSDEQSARTNSVAAAINQLGAATQEIARNAADASQHASGASEQADD
GRQVVEKTIQAMTELSQKISLSCTQIETLNASTDNIGHILDVIKGISQQTNLLALNAAIE
AARAGEAGRGFAVVADEVRNLAHRTQESAEEIHKMITSLQVGSREAVTTMNASQTSSEES
VEVANQAGLRLVSVTQRIGEIDGMNQSVAAATEEQTAVVETLNMDVSHINLLNQQSVANL
NETLKDCDALSQQANRLKQLVDSFKI