Protein Info for Pf6N2E2_3910 in Pseudomonas fluorescens FW300-N2E2

Annotation: Taurine transport ATP-binding protein TauB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00005: ABC_tran" amino acids 21 to 160 (140 residues), 113.4 bits, see alignment E=6.5e-37

Best Hits

Swiss-Prot: 93% identical to TAUB_PSEPF: Taurine import ATP-binding protein TauB (tauB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 97% identity to pba:PSEBR_a276)

MetaCyc: 63% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport ATP-binding protein TauB" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0M6 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Pf6N2E2_3910 Taurine transport ATP-binding protein TauB (Pseudomonas fluorescens FW300-N2E2)
MALLQLERISAQYPGAAEPVLADISLTLGPQQLLVALGPSGSGKTSLLNLIAGFVEPSAG
QITLDGRPVKGPGAERGVVFQDDALLPWQDVLANVGFGLELAGIPKEKREARAREMLALV
DLAGFEHRRIWQLSGGQKQRVGLARALAADPRVLLMDEPFGALDAFTREQMQELLLQVWQ
RTAKPVFLITHDIEEAVFLATDLILLAPNPGQIVERLSLDFGQRYGAGESARSIKSDPRF
IETREHVLAKVFSQRSATRPQERA