Protein Info for Pf6N2E2_3887 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG001957: putative hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00702: Hydrolase" amino acids 9 to 185 (177 residues), 69.1 bits, see alignment E=1e-22 PF12710: HAD" amino acids 12 to 141 (130 residues), 30.7 bits, see alignment E=6.3e-11 PF13419: HAD_2" amino acids 12 to 188 (177 residues), 46.3 bits, see alignment E=7.7e-16 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 92 to 186 (95 residues), 43.2 bits, see alignment E=2.3e-15

Best Hits

Swiss-Prot: 39% identical to YRFG_ECOLI: GMP/IMP nucleotidase YrfG (yrfG) from Escherichia coli (strain K12)

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 97% identity to pba:PSEBR_a298)

MetaCyc: 39% identical to purine nucleotidase (Escherichia coli K-12 substr. MG1655)
5'-nucleotidase. [EC: 3.1.3.5, 3.1.3.99]; 3.1.3.5 [EC: 3.1.3.5, 3.1.3.99]

Predicted SEED Role

"FIG001957: putative hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.99

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GTJ9 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Pf6N2E2_3887 FIG001957: putative hydrolase (Pseudomonas fluorescens FW300-N2E2)
MALLPWHEIDTVLLDMDGTLLDLHYDNHFWLEHLPQRYAELHGVSRAMAEMELQPLFERN
AGQLQWYCLDFWSAELKLPVRELKLETAHLIALRPDADTFLAAIQRAGKRVVMITNAHRD
SLSLKLERIELAPYFDRLISSHDYGFPKENPQFWDALQADLNFDPARSLFIDDTLPVLRS
ARDFGVAHLLAVSEPDSRKGPKDTAEFEALIDYRTLIEGL