Protein Info for Pf6N2E2_3883 in Pseudomonas fluorescens FW300-N2E2

Annotation: C4-dicarboxylate transport transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF00072: Response_reg" amino acids 9 to 118 (110 residues), 99.3 bits, see alignment E=4.5e-32 PF00158: Sigma54_activat" amino acids 148 to 314 (167 residues), 229.1 bits, see alignment E=7.6e-72 PF14532: Sigma54_activ_2" amino acids 149 to 319 (171 residues), 80.2 bits, see alignment E=5.5e-26 PF07728: AAA_5" amino acids 171 to 290 (120 residues), 36.1 bits, see alignment E=1.9e-12 PF07724: AAA_2" amino acids 171 to 276 (106 residues), 29.8 bits, see alignment E=1.8e-10 PF18024: HTH_50" amino acids 401 to 449 (49 residues), 30.7 bits, see alignment 5.9e-11

Best Hits

Swiss-Prot: 79% identical to DCTD_PSEAE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 98% identity to pba:PSEBR_a302)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GL17 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Pf6N2E2_3883 C4-dicarboxylate transport transcriptional regulatory protein (Pseudomonas fluorescens FW300-N2E2)
MTIDNRIEVVLIDDDPHLRQALSQTLDLAGLKILPLAEAKGVAGQLPRDWPGVVVSDIRM
PGMDGLELLNELHAQDAELPVLLITGHGDVPLAVQAMRAGAYDFLEKPFASDHLLDSVRR
ALALRRLVLDNRSLRLALSDRHELSARLVGQSTPMLRLREQIGALAATRADVLILGETGA
GKEVVARALHDLSSRRNGPFVAINAGALAESVVESELFGHEPGAFTGAQKRRIGKFEFAN
GGTLFLDEIESMSLDVQVKLLRLLQERVVERLGGNHQIPLDIRVIAATKEDLRQAADQGR
FRADLYYRLNVAPLRIPPLRERGEDTLMLFQHFADEASARHGLPPHELQPAQRALLLRHS
WPGNVRELQNAAERFALGLELALDNSAPDGNPGAPVELVSGGLSEQVENFEKTLIAAELA
RPHSSVRSLAEALGIPRKTLHDKLRKHGLHFGDSSHGSADESD