Protein Info for Pf6N2E2_386 in Pseudomonas fluorescens FW300-N2E2

Annotation: similar to ribulose-1,5-bisphosphate carboxylase, Type III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF02788: RuBisCO_large_N" amino acids 18 to 133 (116 residues), 33.4 bits, see alignment E=4.6e-12 PF00016: RuBisCO_large" amino acids 144 to 421 (278 residues), 227 bits, see alignment E=3.3e-71

Best Hits

KEGG orthology group: K01601, ribulose-bisphosphate carboxylase large chain [EC: 4.1.1.39] (inferred from 85% identity to ppf:Pput_1846)

Predicted SEED Role

"similar to ribulose-1,5-bisphosphate carboxylase, Type III"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YTU8 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Pf6N2E2_386 similar to ribulose-1,5-bisphosphate carboxylase, Type III (Pseudomonas fluorescens FW300-N2E2)
MVDQTAGREEFTARFFVESSYPIERVGEVIAGEQSSGTFIALPGESAELKERSRARVVSV
KSLPAVTSASLHSEYLARHNPSATYYRGEVEIAFPTANIGPNLPALLTTIAGNLFEIGEV
SGLRVLDVDLPATFAAGFLGPQFGIEGTRKLCGVHDRPIIGTIIKPSIGLTPEQTATVAD
ELCAGGIEFLKDDELLIDPTYASFDARLNAVMPVLHKHADRLGRMPMYAINISGSIDEML
RRHDAVLESGGTCVMLCLNWVGHSGVEHIRKHSQLPIHGHRNGWGAFTRNPQLGFSFEVY
QKIWRLAGIDHLHVNGIQSKFWEPDDSVIASALSCLTPFSGVQPILPVFSSGQWAAQAPT
LFEKLQSVDLMHLAGGGIIGHPLGIGAGIQSMREGWEAATQGIPLQQYAEGRPALTAALA
KFGGV