Protein Info for Pf6N2E2_386 in Pseudomonas fluorescens FW300-N2E2

Annotation: similar to ribulose-1,5-bisphosphate carboxylase, Type III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02788: RuBisCO_large_N
  • amino acids 18 to 133 (116 residues), 33.4 bits, E=4.6e-12
• PF00016: RuBisCO_large
  • amino acids 144 to 421 (278 residues), 227 bits, E=3.3e-71

Best Hits

KEGG orthology group: K01601, ribulose-bisphosphate carboxylase large chain [EC: 4.1.1.39] (inferred from 85% identity to ppf:Pput_1846)

Predicted SEED Role

"similar to ribulose-1,5-bisphosphate carboxylase, Type III"

MetaCyc Pathways

• Rubisco shunt (9/10 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• oxygenic photosynthesis (12/17 steps found)
• nucleoside and nucleotide degradation (archaea) (3/10 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.39

Sequence Analysis Tools

See A0A165YTU8 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Pf6N2E2_386 similar to ribulose-1,5-bisphosphate carboxylase, Type III (Pseudomonas fluorescens FW300-N2E2)
MVDQTAGREEFTARFFVESSYPIERVGEVIAGEQSSGTFIALPGESAELKERSRARVVSV
KSLPAVTSASLHSEYLARHNPSATYYRGEVEIAFPTANIGPNLPALLTTIAGNLFEIGEV
SGLRVLDVDLPATFAAGFLGPQFGIEGTRKLCGVHDRPIIGTIIKPSIGLTPEQTATVAD
ELCAGGIEFLKDDELLIDPTYASFDARLNAVMPVLHKHADRLGRMPMYAINISGSIDEML
RRHDAVLESGGTCVMLCLNWVGHSGVEHIRKHSQLPIHGHRNGWGAFTRNPQLGFSFEVY
QKIWRLAGIDHLHVNGIQSKFWEPDDSVIASALSCLTPFSGVQPILPVFSSGQWAAQAPT
LFEKLQSVDLMHLAGGGIIGHPLGIGAGIQSMREGWEAATQGIPLQQYAEGRPALTAALA
KFGGV