Protein Info for Pf6N2E2_3822 in Pseudomonas fluorescens FW300-N2E2

Annotation: Periplasmic chorismate mutase I precursor (EC 5.4.99.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01806: putative chorismate mutase" amino acids 29 to 141 (113 residues), 115.2 bits, see alignment E=8.8e-38 PF01817: CM_2" amino acids 34 to 102 (69 residues), 48.9 bits, see alignment E=3.2e-17

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a361)

Predicted SEED Role

"Periplasmic chorismate mutase I precursor (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 5.4.99.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.5

Use Curated BLAST to search for 5.4.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0B3 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Pf6N2E2_3822 Periplasmic chorismate mutase I precursor (EC 5.4.99.5) (Pseudomonas fluorescens FW300-N2E2)
MTLRLKLCLALSAALLASTAEAASARAPEALTPLLNAIGERLALGDQVALSKWDSHKPVE
DRQREREVIAAAVAQAPAYKLSGETVEAFFAAQIEANKMVQYINLSDWALEGKAPDLPRP
DLVGEIRPQLDRLQKRLLQQLADFAPYRTDPQCPQWLARATHHNKQHPVHRLALIRATGE
LCISPKA