Protein Info for Pf6N2E2_3655 in Pseudomonas fluorescens FW300-N2E2

Annotation: Hypothetical protein FIG015671 in large core OS assembly cluster

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details PF02585: PIG-L" amino acids 179 to 348 (170 residues), 39.7 bits, see alignment E=3.4e-14

Best Hits

KEGG orthology group: None (inferred from 72% identity to avn:Avin_44690)

Predicted SEED Role

"Hypothetical protein FIG015671 in large core OS assembly cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A050 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Pf6N2E2_3655 Hypothetical protein FIG015671 in large core OS assembly cluster (Pseudomonas fluorescens FW300-N2E2)
MSGRKQQLLKRHRQRKRLILIGMLLVASALGFFVSWWASPLFLLLGWVAHEAWFCDHLFY
APDDDYRYDFPAGTLQFSAILNDGLLQVAGAFEAGQTLILQVRVKSHWLGRFFDPQVWIG
DDRQDLERGVAGERFLNLSGQDSLLASGALRVHGRFCSLAPQATLHVLSNPDFGQQRLLI
IAPHADDAELAAFGLYSRASDVAIVTLTQGEIEADNYRDMGLDMAQAARLKGRLRSWDSL
AVPLWGGVGQQQCVQLGYYCLQLGAMAQQPERSFGSLESGDSDTRDVRRFNALSLPGDVD
GQPSWRNLVADLVGLLEHHRPDAVVTPHPELDPHSDHVAGTRALMEAIELSTWRPRTLLL
YANHLHDNDRWPMGPAGYGIALPPAIEPLPADGLWSPLLDAPTRMDKAMALGMQHDLQGR
PPFKRQLRRMIQRLLAGRRWPRTGEDEFFRKAVRRHELFWTRPLDVSPKDD