Protein Info for Pf6N2E2_3639 in Pseudomonas fluorescens FW300-N2E2

Annotation: 3',5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00149: Metallophos" amino acids 23 to 209 (187 residues), 52.7 bits, see alignment E=7.4e-18

Best Hits

Swiss-Prot: 60% identical to CPDA_PSEAI: 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA (cpdA) from Pseudomonas aeruginosa

KEGG orthology group: K03651, Icc protein (inferred from 93% identity to pba:PSEBR_a517)

Predicted SEED Role

"3',5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17)" in subsystem cAMP signaling in bacteria (EC 3.1.4.17)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZY2 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Pf6N2E2_3639 3',5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17) (Pseudomonas fluorescens FW300-N2E2)
VRLGESDLPNVSILTTADAALLVQLSDSHLFAEADGSLLGMNTRDSLRAVVDLVLEQQPK
IDLMLATGDLSQDGTLESYQAFRQMSGRIDAPARWIPGNHDEPQVMLEAAVKSTLLEPVV
DIGNWRVTLLDSAVPGSVPGFLAEEQLILLANALSEAPERHHLVCLHHHPVSIGCVWMEP
IGLRNPEALFAVLDRFPQVRAVLWGHVHQEVDRVREGVRLLASPSTCIQFEPGSEDFAVG
LQAPGYRWLRLWPDGRLETGVERVVGFAFTPDYESDGY