Protein Info for Pf6N2E2_3637 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): yqiA-like hydrolase, affects the cell envelope
Rationale: PFam PF05728.8 (UPF0227). conserved phenotypes: important for resisting doxycycline and for octanoate utilization (also a putative stress)
Original annotation: Putative esterase, FIGfam005057

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF05728: UPF0227" amino acids 5 to 187 (183 residues), 209.8 bits, see alignment E=3.4e-66

Best Hits

KEGG orthology group: K07000, (no description) (inferred from 96% identity to pba:PSEBR_a519)

Predicted SEED Role

"Putative esterase, FIGfam005057"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A230 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Pf6N2E2_3637 yqiA-like hydrolase, affects the cell envelope (Pseudomonas fluorescens FW300-N2E2)
MSGSILYIHGFNSAPASTKASQLINVMAQLGLSDHLQVPALHHHPRQAIGQLEQAIAQLG
RPLLVGSSLGGYYATHLAERHGLKALLINPAVSPHRMFDGYLGTQKNLYTDETWELTHDH
VTALAELDVPAPRDPQRFQVWLQTGDETLDYRHAQQYYRACALRIQAGGDHSFQGFAQQL
PALLSFAGIGADLYQAIDFTSL