Protein Info for Pf6N2E2_3576 in Pseudomonas fluorescens FW300-N2E2

Annotation: Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00005: ABC_tran" amino acids 21 to 165 (145 residues), 113.2 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 59% identical to LIVF_SALTI: High-affinity branched-chain amino acid transport ATP-binding protein LivF (livF) from Salmonella typhi

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 99% identity to pba:PSEBR_a574)

MetaCyc: 59% identical to branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivF (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZH33 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Pf6N2E2_3576 Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1) (Pseudomonas fluorescens FW300-N2E2)
MSGPILELKELDVFYGPIQALKKVSMHIGEGETVSLIGSNGAGKSTLLMSIFGQPRAAGG
QIIYQGVDITHKSSHYIASNGIAQSPEGRRVFPDMTVEENLLMGTIPIGDKYASEDMQRM
FELFPRLKERRNQRAMTMSGGEQQMLAIARALMSRPKLLLLDEPSLGLAPIVVKQIFATL
RELASTGMTIFLVEQNANHALKLSDRAYVMVNGEIRLTGTGKELLANEEVRNAYLGGH