Protein Info for Pf6N2E2_349 in Pseudomonas fluorescens FW300-N2E2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details PF02517: Rce1-like" amino acids 141 to 233 (93 residues), 40.6 bits, see alignment E=1.3e-14

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a3513)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YSN1 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Pf6N2E2_349 hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MIAEGLVVLLDYTLYLLPSLALFGLWFALTPKTQTALRIVIVLLAFVLMRDAMTPLGMWS
LNGDLQIGFLANPFVLAMLGASSLLLVALSARLLPDLWQLVVLFKGNRLAGLVLGIAVGC
LIGLPLRLSQGAETAIPGYWAWLLGMTVLAYGANALEEVLFRGFLQGYLELHVSALRAAL
ISAVAFSALHAFLALSVTPLGWPVLLFTLIEGLACGLIRMRYGVVASSATHGTAILLIAV
PMMS