Protein Info for Pf6N2E2_3407 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative solute-binding component of ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00497: SBP_bac_3" amino acids 37 to 259 (223 residues), 82.8 bits, see alignment E=1.9e-27 PF09084: NMT1" amino acids 109 to 186 (78 residues), 23.5 bits, see alignment E=4.8e-09

Best Hits

KEGG orthology group: None (inferred from 77% identity to pol:Bpro_1391)

Predicted SEED Role

"putative solute-binding component of ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZF2 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Pf6N2E2_3407 putative solute-binding component of ABC transporter (Pseudomonas fluorescens FW300-N2E2)
MKTSKVKRFSGICAGFLVSVLAAAPVFALETVEPGSLTIAFSGDMPGTGYQDSRMVGYDG
EILQQISEKLGLKVKPALMEWSGTIASVQSKRVDVMAGTMGWTEQRSKIMTLSDPIHYFK
NGITQTDKTNWNSLKDLQGKKVGTITGFSFIPEMRKIDGLQVALYDTSDAAVRDLLAGRI
DAVIGDPPVMQYAISRNEQWHLHFNAFVDNDPNFPLLTGLGQVVFGFNKASPELVTAVNA
QIQTLWKNCEMRKIGARYGLTQDVWFMPEGKDLRLGVDRPADWTLPGCK