Protein Info for Pf6N2E2_3353 in Pseudomonas fluorescens FW300-N2E2

Annotation: Translation initiation factor 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 839 PF04760: IF2_N" amino acids 1 to 51 (51 residues), 27 bits, see alignment 1.1e-09 amino acids 264 to 314 (51 residues), 57.3 bits, see alignment 3.8e-19 PF08364: IF2_assoc" amino acids 61 to 95 (35 residues), 40.9 bits, see alignment (E = 6.7e-14) TIGR00487: translation initiation factor IF-2" amino acids 258 to 838 (581 residues), 857 bits, see alignment E=8.4e-262 TIGR00231: small GTP-binding protein domain" amino acids 342 to 498 (157 residues), 104.4 bits, see alignment E=5.4e-34 PF00009: GTP_EFTU" amino acids 343 to 499 (157 residues), 129.6 bits, see alignment E=3.9e-41 PF01926: MMR_HSR1" amino acids 344 to 449 (106 residues), 38.3 bits, see alignment E=4.6e-13 PF22042: EF-G_D2" amino acids 516 to 593 (78 residues), 104.6 bits, see alignment E=8.5e-34 PF11987: IF-2" amino acids 615 to 729 (115 residues), 133.9 bits, see alignment E=9.4e-43

Best Hits

Swiss-Prot: 96% identical to IF2_PSEPF: Translation initiation factor IF-2 (infB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 100% identity to pba:PSEBR_a777)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZ46 at UniProt or InterPro

Protein Sequence (839 amino acids)

>Pf6N2E2_3353 Translation initiation factor 2 (Pseudomonas fluorescens FW300-N2E2)
MTQVTVKQLADEVKTPVERLLQQMREAGLPHTAAEEHVTDSEKQSLLTHLKSSHKAKVEE
PRKITLQRKTTSTLRVAGSKSISVEVRKKKVFVQRSPEEIEAERKREQEERRAVENAARQ
KAEEEAKRRAEEEARRQPAAAQAAPVEAVEAVAPVAEPVREAAPVVAAAPAPADTRKRDE
QRRPDKPRADDNRRGSGDGERKNAPHRASVKEKAPAPRVAPRTTDEESDGFRRGGRGKAK
LKKRNAHGFQSPTGPVVREVKIGETITVGDLAQQMSVKAAEIIKFMFKLGTPATINQVLD
QETAQLVAEELGHKVTLVSDTALEDSLAESLKFEGEAVSRAPVVTVMGHVDHGKTSLLDY
IRRAKVAAGEAGGITQHIGAYHVETDRGMVTFLDTPGHAAFTAMRARGAKATDIVILVVA
ADDGVMPQTIEAVQHAQAAGVPLVVAVNKIDKPGADLDRIRSELSVHGVTSEEWGGDTPF
VPVSAKMGTGVDELLEAVLLQAEVLELTATPSAPGRGVVVESRLDKGRGPVATVLVQDGT
LRQGDMVLVGSNYGRVRAMLDENGKSIKEAGPAIPVEILGLDGTPDAGDEMSVVADEKKA
REVALFRQGKFREVKLARAHAGKLENIFENMGQEEKKTLNIVLKSDVRGSLEALNGALNG
LGNDEVQVRVVGGGVGGITESDANLALASNAVLFGFNVRADAGARKIVEQEGLDMRYYNV
IYDIIEDVKKALTGMLGSDVRENILGVAEVRDVFRSPKFGAIAGCMVIEGVVHRNRPIRV
LREDIVIFEGELESLRRFKDDASEVRAGMECGIGVKSYNDVKVGDKIEVFEKVQVARSL