Protein Info for Pf6N2E2_3319 in Pseudomonas fluorescens FW300-N2E2

Annotation: Peptide synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 transmembrane" amino acids 35 to 49 (15 residues), see Phobius details amino acids 498 to 515 (18 residues), see Phobius details PF00501: AMP-binding" amino acids 2 to 315 (314 residues), 199.4 bits, see alignment E=1.3e-62 TIGR01733: amino acid adenylation domain" amino acids 2 to 386 (385 residues), 328.4 bits, see alignment E=3e-102 PF13193: AMP-binding_C" amino acids 372 to 449 (78 residues), 31 bits, see alignment E=6.1e-11 PF00550: PP-binding" amino acids 478 to 537 (60 residues), 43.7 bits, see alignment 4e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1G0 at UniProt or InterPro

Protein Sequence (542 amino acids)

>Pf6N2E2_3319 Peptide synthetase (Pseudomonas fluorescens FW300-N2E2)
VDTDSQRIAAYLAHNAIGAGAVVVIGCPRGKDLLVALLGVMKSGAAFILMDLDAAPARLS
VQLDAANAKLVLVPDGYIVGNNPALVAEKVVTLGQARDTAQSLHFEQPRIAPQDLAYIIF
TSGSTGQPKGVMVSHRGIPNLAHHALTYGITQGSRVLMFSPVCFDAIIAEITMTLFAGGC
LVAVADHELWDFDNLQNLLCNRRIDVATLPPSLVSLLPSELPISLSTLIVAGERCNKEVI
VNWASKTRLINAYGPSEATVATTVKLCSLDTSPADIGQAISNVTVRLLDEALEDVPDGEL
GEIYISGVGVALGYLGNPDLSDARFIRGLAGDDSLSFRTGDFARRDVNAGILFEGRKDDL
VKINGNRVELAEIEACAMASRLIRSCHACCVDAGTSGVRISLFVTPSDKADDGRLEPELR
ARISAELPAYFMPARIVVLDELPRNPAGKVDRAALIAQLGDLVEEGGAPKAMTPQEETLA
LIWAQILGRPIENREANFFALGGNSLLAMRLVALMKRSGIQINLKRVFGAPTLAKMACLM
EG