Protein Info for Pf6N2E2_3269 in Pseudomonas fluorescens FW300-N2E2

Annotation: PTS IIA-like nitrogen-regulatory protein PtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01419: PTS IIA-like nitrogen-regulatory protein PtsN
  • amino acids 3 to 134 (132 residues), 165.2 bits, E=4.4e-53
• PF00359: PTS_EIIA_2
  • amino acids 6 to 133 (128 residues), 111.8 bits, E=1.4e-36

Best Hits

Swiss-Prot: 75% identical to PTSN_PSEAE: Nitrogen regulatory protein (ptsN) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 100% identity to pba:PSEBR_a844)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

See A0A159ZYX6 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Pf6N2E2_3269 PTS IIA-like nitrogen-regulatory protein PtsN (Pseudomonas fluorescens FW300-N2E2)
VNAPGGSKKKALEHIANLIHREVPDLEMQDVFEALVAREKLGSTGFGNGIAIPHCRLKGC
AAPISALLHLETAIDFDAIDGAPVDLLFVLLVPEAATDAHLELLRQIASMLDRKEVREKL
RSAPSNEALYQVVLDEQNGH