Protein Info for Pf6N2E2_3253 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): ATP phosphoribosyltransferase (EC 2.4.2.17)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00070.
Original annotation: ATP phosphoribosyltransferase (EC 2.4.2.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR00070: ATP phosphoribosyltransferase" amino acids 2 to 182 (181 residues), 183.4 bits, see alignment E=1.9e-58 PF01634: HisG" amino acids 51 to 202 (152 residues), 176.7 bits, see alignment E=1.7e-56

Best Hits

Swiss-Prot: 96% identical to HIS1_PSEFS: ATP phosphoribosyltransferase (hisG) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 100% identity to pba:PSEBR_a859)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXA6 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Pf6N2E2_3253 ATP phosphoribosyltransferase (EC 2.4.2.17) (Pseudomonas fluorescens FW300-N2E2)
MLTIALSKGRILDDTLPLLAEAGIVPTENPDKSRKLIIPTTQADVRLLIVRATDVPTYVE
HGAADLGVAGKDVLMEYGGQGLYEPLDLQIARCKLMTAGKVGAPEPKGRLRVATKFVNIA
KRYYAEQGRQVDIIKLYGSMELAPLIGLADKIIDVVDTGNTLRANGLEPQDFIADITSRL
IVNKASMKMQHARIQALIDTLRKAVESRHRG