Protein Info for Pf6N2E2_3231 in Pseudomonas fluorescens FW300-N2E2

Annotation: Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 101 to 127 (27 residues), see Phobius details amino acids 140 to 171 (32 residues), see Phobius details amino acids 220 to 246 (27 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF12911: OppC_N" amino acids 29 to 75 (47 residues), 35.9 bits, see alignment 5.7e-13 PF00528: BPD_transp_1" amino acids 116 to 297 (182 residues), 104.8 bits, see alignment E=4.9e-34

Best Hits

Swiss-Prot: 46% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 96% identity to pba:PSEBR_a883)

MetaCyc: 39% identical to nickel ABC transporter membrane subunit NikC (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZX86 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Pf6N2E2_3231 Dipeptide transport system permease protein DppC (TC 3.A.1.5.2) (Pseudomonas fluorescens FW300-N2E2)
MNLPLASSAPAALPASSTAAMAASTLRLLRFLLRNPMTFAGLIVVATLMLVAVFAPWIAG
HDPLLQNLAGALQAPSGVHWFGTDEYGRDVFARLVYGSRITLYIVLLVTVIVGPIGLLVG
TVSGYFGGWVDSLFMRITDIFISFPSLVLALAFIAALGPGLEHAVIAIALTAWPPIARLA
RAETLPLRNADFVVAVQLQGASSTRIILRHIIPMCLSSVIIRLTMNMASIILTAAALGFL
GLGAQAPLPEWGAMISTGRRYMLESWWLVAAPGAAIMLVSLAFNLLGDGLRDVLDPRSQS