Protein Info for Pf6N2E2_317 in Pseudomonas fluorescens FW300-N2E2

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF14361: RsbRD_N" amino acids 3 to 107 (105 residues), 26.5 bits, see alignment E=1.3e-09 PF00512: HisKA" amino acids 151 to 214 (64 residues), 47.6 bits, see alignment E=2.1e-16 PF02518: HATPase_c" amino acids 261 to 374 (114 residues), 78.1 bits, see alignment E=1e-25

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a3541)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YRV2 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Pf6N2E2_317 Signal transduction histidine kinase (Pseudomonas fluorescens FW300-N2E2)
MRLADFILDNIEPILQAWEDFAKTITPASIGMDSVALRDHAEQMLRTIAADLRTSQTRNE
AIAKSHGEAPPVDAETAAETHAVIRQSSGFTVEQMVSEYRALRTSVLMLWMPHTQLDHKQ
VMDDLIRFNEAVDQALAESVVSYSGAVDASRNIFLGILGHDLRSPLGAILLSSEVLLRAG
DLPAKATKITSRIYTSVKRANKIVGDLLDFTRTQLGSGIPVQRFKGDLVAACEGMVEEAR
AYHPESEIRFETTGALEGVFDPARMEQVFANLIGNAVQHGAEGTPVTVSLSVEKDRAVIA
INNQGKPIEKEAISSLFNPMIRHLRSGEMQYGSTAGLGLGLHIASAIVSAHNGTIEVHSK
ARVGTTFTVRIPLNPA