Protein Info for Pf6N2E2_3153 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permeases of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 35 to 52 (18 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 146 (26 residues), see Phobius details amino acids 159 to 184 (26 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 23 to 232 (210 residues), 93 bits, see alignment E=2e-30 amino acids 258 to 434 (177 residues), 51 bits, see alignment E=1.1e-17 PF07690: MFS_1" amino acids 26 to 293 (268 residues), 52.6 bits, see alignment E=3.6e-18 amino acids 285 to 431 (147 residues), 44.1 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 48% identical to Y281_HAEIN: Putative metabolite transport protein HI_0281 (HI_0281) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_1015)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYW1 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Pf6N2E2_3153 Permeases of the major facilitator superfamily (Pseudomonas fluorescens FW300-N2E2)
MTTATCNEAVSAQPTNSTTRVATASFIGTAIEFYDFYVYATAAALVIGPVFFPQTSGTAQ
MLSSFLTFGIAFLARPLGSALFGHFGDRIGRKSTLVASLLLMGVCTTLIGVLPGYASIGA
WAPILLCVLRFGQGLGLGGEWGGAALLATENAPKGKRAWFGMFPQLGPSIGFLAANGLFL
TLAMGLDDEQFRAWGWRIPFLLSAVLVIVGLYVRLKLHETPVFANAMARQERVKVPLVEL
FSQYWAPTLLGAAAMVVCYALFYISTVFSLSYGVSTLGYSRETFLGLLCFAVLFMAAATP
LSAWASDRYGRKPVLIGGGVLAIASGFLMEPLLTHGSTSGVALFLCIELFLMGVTFAPMG
ALLPELFPTHVRYTGASAAYNLGGIVGASAAPFFAQKLVAMGGLSYVGGYVSGAAVLSVI
AVLCLKETRHNDLNRVA