Protein Info for Pf6N2E2_3151 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glutamate synthase [NADPH] small chain (EC 1.4.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 128 to 154 (27 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 43 to 267 (225 residues), 136.2 bits, see alignment E=6.5e-44

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a988)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A109 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Pf6N2E2_3151 Glutamate synthase [NADPH] small chain (EC 1.4.1.13) (Pseudomonas fluorescens FW300-N2E2)
MLPLSPSLLATLAAACLYAAATLYQGTRLATGAKANKRLLVTLGVLAVLGHAASLYTHLM
TPIGLGLDFFNAASLIAVAVIGLTLIACSRIPVENLLVLLFPLGLATVLLAQFAPSGTVQ
IIDEEPGILAHILLSILAYGLFTIAVFQALLLLVQDHQLKNKHPSGLIRNFPPLQTMESL
LFGFLWAGWSLLSLSLISGWLFVENLFAQHLVHKTLLACLAWIVFSVLLWGRNRLGWRGH
KAIRWTLAGFCLLMLAYFGSKLVREYILHV