Protein Info for Pf6N2E2_3148 in Pseudomonas fluorescens FW300-N2E2

Annotation: 16S rRNA processing protein RimM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 TIGR02273: 16S rRNA processing protein RimM" amino acids 11 to 177 (167 residues), 179.6 bits, see alignment E=1.6e-57 PF01782: RimM" amino acids 13 to 94 (82 residues), 89.5 bits, see alignment E=2e-29 PF05239: PRC" amino acids 102 to 173 (72 residues), 32.6 bits, see alignment E=9.7e-12 PF24986: PRC_RimM" amino acids 106 to 175 (70 residues), 38.5 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 96% identical to RIMM_PSEF5: Ribosome maturation factor RimM (rimM) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 99% identity to pba:PSEBR_a991)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VZZ7 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Pf6N2E2_3148 16S rRNA processing protein RimM (Pseudomonas fluorescens FW300-N2E2)
MNATPKDADDLIVVGKIYSVHGVRGEVKVYSFTDPIKNLLDYKTWTLKREGSVKQVELVS
GRGNDKFLVAKLKGLDDREEARLLAGYEICVPRNLFPELTDGEYYWYQLVGLKVIDHLGQ
LLGKIDHLLETGSNDVMVVKPCVGSLDDRERLLPYTEQCVLAVDLAAGEMKVEWDADF