Protein Info for Pf6N2E2_3130 in Pseudomonas fluorescens FW300-N2E2

Annotation: Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 5 to 24 (20 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 71 to 241 (171 residues), 43.9 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 81% identical to YDCV_ECOLI: Inner membrane ABC transporter permease protein YdcV (ydcV) from Escherichia coli (strain K12)

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 98% identity to pfo:Pfl01_1045)

MetaCyc: 81% identical to putative ABC transporter membrane subunit YdcV (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0Z5 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Pf6N2E2_3130 Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1) (Pseudomonas fluorescens FW300-N2E2)
LRIAAWGGLVFLHFPILIIFLYAFNTEDAAFSFPPKGLTLKWFSVAFSRPDVLEAIKLSL
QVAAIATLIAMVLGTLASAALYRRDFFGKQGISLMLILPIALPGIITGIALLATFKTLGI
EPGMFTIVVGHATFCVVIVYNNVIARLRRTSHSLIEASMDLGADGWQTFRYIILPNLGSA
LLAGGMLAFALSFDEIIVTTFTAGHERTLPLWLLNQLSRPRDVPVTNVVAMLVMIVTMLP
ILGAYYLTRGGESVAGSGGK