Protein Info for Pf6N2E2_3128 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00005: ABC_tran" amino acids 22 to 162 (141 residues), 117.1 bits, see alignment E=1.4e-37 PF08402: TOBE_2" amino acids 257 to 337 (81 residues), 51.6 bits, see alignment E=1.3e-17

Best Hits

Swiss-Prot: 70% identical to YDCT_ECOLI: Uncharacterized ABC transporter ATP-binding protein YdcT (ydcT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a1011)

MetaCyc: 70% identical to putative ABC transporter ATP-binding protein YdcT (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYM3 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Pf6N2E2_3128 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1) (Pseudomonas fluorescens FW300-N2E2)
MTLAVQFTQVSRQFGDVKAVDRVCIDIQDGEFFSMLGPSGSGKTTCLRLIAGFEQPSAGS
IRIHGEEATGLAPYQRDVNTVFQDYALFPHMNVRDNVAYGLKVKGVAKAERIKRADEALE
MVALGGYGERKPVQLSGGQRQRVALARALVNRPRVLLLDEPLGALDLKLREQMQGELKKL
QRQLGITFIFVTHDQTEALSMSDRVAVFNKGRIEQVDTPRNLYMKPATTFVAEFVGTSNV
IRGELARELSGYPQPFSIRPEHVRFAEGPLASGEIEVHGLLHDIQYQGSATRYELKLANG
QTLNLSQANTQWLDNTAQHQTGQHLSVRWAREAMVALHDTVSGEV