Protein Info for Pf6N2E2_3077 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG138056: a glutathione-dependent thiol reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 TIGR01617: transcriptional regulator, Spx/MgsR family" amino acids 8 to 118 (111 residues), 100.2 bits, see alignment E=4.5e-33 PF03960: ArsC" amino acids 11 to 116 (106 residues), 76.5 bits, see alignment E=8.3e-26

Best Hits

Swiss-Prot: 41% identical to Y103_HAEIN: Uncharacterized protein HI_0103 (HI_0103) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1057)

Predicted SEED Role

"FIG138056: a glutathione-dependent thiol reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0V5 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Pf6N2E2_3077 FIG138056: a glutathione-dependent thiol reductase (Pseudomonas fluorescens FW300-N2E2)
MPKENKHLQLFGIKACDTMKKARTWLDEHAVRYDFHDYKTAGIDREHLTQWCNEHGWQVV
LNRAGTTFRKLDDERKADLDQTKAIELMLAQPSMIKRPVLDLGDRTLIGFKPDIYAAEIK