Protein Info for Pf6N2E2_3016 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phage tail length tape-measure protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 transmembrane" amino acids 453 to 475 (23 residues), see Phobius details amino acids 589 to 609 (21 residues), see Phobius details amino acids 615 to 634 (20 residues), see Phobius details TIGR01760: phage tail tape measure protein, TP901 family, core region" amino acids 102 to 467 (366 residues), 110.8 bits, see alignment E=3.6e-36 PF10145: PhageMin_Tail" amino acids 150 to 352 (203 residues), 61.2 bits, see alignment E=6.5e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYE3 at UniProt or InterPro

Protein Sequence (725 amino acids)

>Pf6N2E2_3016 Phage tail length tape-measure protein (Pseudomonas fluorescens FW300-N2E2)
MADDRYSLKYAAFNESGLAFGNTSPTNGVSAQGTFARDQLSGLDLALEKLGLKLGLLTTA
IESLTVKLSAQRLFSQTMGAGAKGESANEPKGKSGGGIEPPALLKPAIAMDSAMADLKQA
GHFTPRQIAEMAEPTQRIASAPLVAAGGTTAVEVVRMQSLAARAGVGSDLPSASDRQLAL
LRFASDAGVTASTFKMPAMEAAEMLLGWRTSMKLSAEKAFDLADATNHLSKIPGGAKASE
IGTVLQRDGAAATSAGLQPAQAAALTAALLNTGAQQAEAGVALDHFTTALGKGDQASATE
QAAWKQLGLDPKAVASGLRDKDAAPGTVMSVLAALNAQPAEKRSSLASSLFGSGDAAVLR
MSQKLDDVNAAFWQVKDPGQYATSQLDNNGSVRQDALALSNTRQGQLNVLNARSERLSLA
AGNALMPSTDTSFQWLGSLADGMSELAESSPKAAAAIVLIGAAIKPLVGALLKAVGDEMS
NQVAKRVLGKVAPHLPGRLGEVISEDFRNPRGDKLDTRNANQRPESTSRTKIRVSTRGSL
GGAGRFSPGPTASLRSMTRRAPGPLKVVGAVADVAEGVLTGDKRMMGAGLGAAGGGWAGA
AAGSAAGAALGSVVPVIGTAIGGLVGGLLGGWLGSDAGASLGEKLVAPADRLAAPDQVSK
DLASTQTTTQQNTMTANIYINGQDQASASQLANLVVQQLSGQFGLTTMPNSLAMRSDAAL
TDGGT