Protein Info for Pf6N2E2_2939 in Pseudomonas fluorescens FW300-N2E2

Annotation: Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 4 to 215 (212 residues), 291.4 bits, see alignment E=2e-91 PF12766: Pyridox_oxase_2" amino acids 30 to 116 (87 residues), 39.9 bits, see alignment E=8.1e-14 PF01243: PNPOx_N" amino acids 46 to 151 (106 residues), 95.8 bits, see alignment E=3.6e-31 PF10590: PNP_phzG_C" amino acids 175 to 215 (41 residues), 72 bits, see alignment 4.4e-24

Best Hits

Swiss-Prot: 90% identical to PDXH_PSEPF: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 99% identity to pba:PSEBR_a1171)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYN9 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Pf6N2E2_2939 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (Pseudomonas fluorescens FW300-N2E2)
MTQPLADMRRDYTRDGLTEAQAPAEPFALFHQWFADAVKTEQAPVEANAMTLATVDAEGR
PHCRILLLKGLDALGFTFFTNYDSAKGQQLAANPFAAMTFFWPALERQVRIEGKVVKVTA
QESDAYYQVRPLGSRLGAWASPQSRVIAGRGELDDLLKATEQRFSDSQPHCPEHWGGYRL
LPERIEFWQGRPSRLHDRLNYRLQGAQWTRERLAP