Protein Info for Pf6N2E2_2924 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): ABC transporter for L-leucine/L-isoleucine/L-phenylalanine/D-alanine, permease component 2 LivM
Rationale: Important for utilization of leucine, phenylanine, or D-alanine. Slightly important for utilization of isoleucine as a carbon source and detrimental when isoleucine is the nitrogen source.
Original annotation: Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 92 to 108 (17 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 195 to 211 (17 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 349 to 376 (28 residues), see Phobius details amino acids 388 to 405 (18 residues), see Phobius details PF11862: DUF3382" amino acids 3 to 105 (103 residues), 64.8 bits, see alignment E=7.1e-22 PF02653: BPD_transp_2" amino acids 114 to 399 (286 residues), 190.7 bits, see alignment E=2.9e-60

Best Hits

Swiss-Prot: 76% identical to BRAE_PSEAE: High-affinity branched-chain amino acid transport system permease protein BraE (braE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 99% identity to pba:PSEBR_a1185)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYE0 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Pf6N2E2_2924 ABC transporter for L-leucine/L-isoleucine/L-phenylalanine/D-alanine, permease component 2 LivM (Pseudomonas fluorescens FW300-N2E2)
MTRHLKSALFSALLVWAVAYPVLGLKLTIVGINLEVHGTSPAILATIAVCSLLMFLRVLF
STQISAMWKSSPGLPVIPAKASNFLTLPTTQRWIVLALIVGALVWPFFGSRGAVDIATLI
LIYVMLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYALLSHYFGLSFWICLPIAGMMAATF
GFLLGFPVLRLRGDYLAIVTLGFGEIIRLFLRNLTDITGGPNGISNIEKPTFFGLTFERK
AAEGLQTFHEYFGLEYNSINKVIFLYLVALLLALAALFVINRLLRMPIGRAWEALREDEI
ACRALGLNPTVIKLSAFTLGAAFAGFAGSFFAARQGLVTPESFTFIESAIILAIVVLGGM
GSQLGVILAAIVMILLPEMMREFSEYRMLMFGALMVLMMIWRPQGLLPMQRPHMELRK