Protein Info for Pf6N2E2_2879 in Pseudomonas fluorescens FW300-N2E2

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 373 to 389 (17 residues), see Phobius details amino acids 401 to 420 (20 residues), see Phobius details amino acids 426 to 443 (18 residues), see Phobius details amino acids 449 to 469 (21 residues), see Phobius details amino acids 481 to 500 (20 residues), see Phobius details PF04632: FUSC" amino acids 16 to 652 (637 residues), 633 bits, see alignment E=1.1e-193 PF06081: ArAE_1" amino acids 20 to 105 (86 residues), 31.2 bits, see alignment E=3.3e-11 PF13515: FUSC_2" amino acids 28 to 157 (130 residues), 44.5 bits, see alignment E=2.6e-15

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1225)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYB0 at UniProt or InterPro

Protein Sequence (666 amino acids)

>Pf6N2E2_2879 membrane protein, putative (Pseudomonas fluorescens FW300-N2E2)
VPITFQALFAPDRLALQFAIKTVLGAGLALWLALRWGLEQPSWALMTAIIVAQPLSGMVV
QKGLARLVGTLVGTVMSVVFMGLFAQAPWLFLLALALWLGLCTACSTLLRSAWSYSFVLA
GYTVAIIALPAISHPLGVFDQAVARCTEISLGIVCATAASALLWPLRVERQLAGQALAAW
QSGMQAARATLAGDVQARKGLLEILGRIVAVDAQREHAWFEGSRGRQRARAISGLSQKLL
MLLRLSRSVRRQWKQLDPEEAEALQPWMNEVQQALDADSATLQALRPRVWDASHDPQISS
AQSYCLARFALLLDTALAACAALTAVQEGREAADPPRTLAPHRDLSLAMVFGARSALAFL
AVACFWLATAWPAASGALVLTCVVCSLFASRENGAQIGMSFLRGILLAVPTAFVLGELLL
PQWSSFAMLCMAMGVPLFFGALGMAKPQIFATATSFCLHFVVLISPLNAMKYDVAAFFNN
AQAMMIGVGAAVLAFNVLILRNPAWHSRRLLAATLHDLVRLTHRSLRGAESWFGGRMADR
LLQLARHYPELPVQARSRWDDGLLGLDIGDELLHLRLSLAVAQVPDTRAQRRYFEALEQV
LEHGPTGDQADALAPASAEFLKVLSTQPPGDALKLAQGAVVQLQNSWRAWCHQHEPERRE
HSHGLA