Protein Info for Pf6N2E2_2804 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG00955946: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF07411: DUF1508" amino acids 11 to 57 (47 residues), 69.9 bits, see alignment E=6.6e-24 amino acids 62 to 108 (47 residues), 72.6 bits, see alignment E=9.6e-25

Best Hits

Swiss-Prot: 66% identical to Y3888_SHEON: UPF0339 protein SO_3888 (SO_3888) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K09946, hypothetical protein (inferred from 98% identity to pba:PSEBR_a1298)

Predicted SEED Role

"FIG00955946: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZY51 at UniProt or InterPro

Protein Sequence (114 amino acids)

>Pf6N2E2_2804 FIG00955946: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MSGWYEISKSSSGQFRFVLKAANAETILTSELYTTRSGVEGGIASVQKNSPLAERYELKN
TKDGHPYFNLKAANHEVIGSSEAYSSDAARDKGIASVKANGPTTVIKDKTVAAL