Protein Info for Pf6N2E2_2783 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sensory box/GGDEF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 78 to 240 (163 residues), 114.7 bits, see alignment E=1.8e-37 PF00990: GGDEF" amino acids 81 to 237 (157 residues), 122.7 bits, see alignment E=6.5e-40

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a1316)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZY37 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Pf6N2E2_2783 Sensory box/GGDEF family protein (Pseudomonas fluorescens FW300-N2E2)
MSLRSPLYSQRKPLLAVVALLGTGFLIIALLGYYAAHASVRDNILKTLYLNLLIGILVTL
AVLAILYRLINSYQQRIDAQATLDSLTELPNRRGFDLLAVQALHEAQREPKPLTALLMEL
DDFKRLDTTHGHVATDQLLAGFARDLTQNLRHSDIVCRWSTEAFVVLLKDIDGQTGLKIA
EKIRQRIETQRYFCSGKQLLVTVSIGLTTLQDEDVLHTLLLRTDHALQRARQTGCNRICV
EMPHSSYE