Protein Info for Pf6N2E2_2743 in Pseudomonas fluorescens FW300-N2E2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 195 to 216 (22 residues), see Phobius details PF02203: TarH" amino acids 11 to 171 (161 residues), 31.9 bits, see alignment E=2.4e-11 PF12729: 4HB_MCP_1" amino acids 13 to 181 (169 residues), 50.1 bits, see alignment E=5.2e-17 PF00672: HAMP" amino acids 215 to 263 (49 residues), 46.5 bits, see alignment 7.3e-16 PF00015: MCPsignal" amino acids 328 to 510 (183 residues), 135.1 bits, see alignment E=4.7e-43

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 88% identity to pba:PSEBR_a1351)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A052 at UniProt or InterPro

Protein Sequence (544 amino acids)

>Pf6N2E2_2743 Methyl-accepting chemotaxis protein (Pseudomonas fluorescens FW300-N2E2)
MLRFFADLGFRWKITLPIAFLAVLLVLMGWAGMRGIGQVTESSTQLTKRYLPAISLLLNA
DRDLYQAFVAERSLLDGHANEHLKALSTSHGENAKQAYDRVQKYAAMQPGAEAQALVSQF
NDSFGKWMQVSRRVLELSVGDPQGASALSFGDSERLFETMRDSIDKLGELEDAASHREGD
AAIENGETVGVHQGVILLVGLLGCILVLVVLPLVVLSPMRRLLHRVEQIAEGGGDLKGRL
EVRSADELGQLGSAFNRFLDKLQPLIAEVGRVTGEVDSAARAMADMAATNDRLISSEHAA
LDQVSTAATQMSAAVHEVAHNAANASGAAQQASSQSRDGAEVVSSTIESIRQLAQEVESA
SGTIEALAQETSSIGAVLEVIRGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALA
ARTQDSTKDIQVRIERLQSGVAKAVQAMHVGSTKARDSVERAAGVDQVLSGTGGSIQQIN
DMAAQIASACEEQSSVTEEIARNISDIRDLSNEAAANSAQSMHASQQLSSLSRNLAELTG
RFRT